PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016471-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 410aa    MW: 46152.4 Da    PI: 4.5626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016471-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g+ R++k+c++rw +yl
    NNU_016471-RA 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.72e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++  +d++++lG++ W++Ia++++ gRt++++k++w+++
    NNU_016471-RA  70 LSESEEQTVIDLHARLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.636961IPR017930Myb domain
SuperFamilySSF466891.5E-2611108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-141461IPR001005SANT/Myb domain
CDDcd001671.38E-81661No hitNo description
PROSITE profilePS5129426.64862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2464117IPR009057Homeodomain-like
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002499.8E-1570111IPR001005SANT/Myb domain
CDDcd001676.03E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SESEEQTVID LHARLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHKPIS ISTEQPQQVH NCPMVAIDEE DQNKSQETSM QSSITEIKEE NQINTSPFIY  180
TDNSDGFCTD EVPMVELDEI LVPRRPSSST SSSSSSGSYG KQEDLQSSIT EMKEENKIST  240
SPFSYTDNSD GFWTDEVPMI KLDEILVPCL PSSLTSSSSS SSGSYGKQEH LQSSITEIKE  300
ENQISTSPFS YKDNSDGFCT DEVPMIELDE ILVPCLPSSS TSSSPSSGSY GKQEDLLFSS  360
LEWPDYDDIS FWSDFNCWDL ISEDGDRKLA VDPPLSQHSR MILDQESWKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-27121162105C-Myb DNA-Binding Domain
1msf_C1e-27121162105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010271304.10.0PREDICTED: myb-related protein 315
TrEMBLA0A061EGV91e-105A0A061EGV9_THECC; Myb domain protein 20
STRINGGLYMA14G39530.11e-101(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.12e-94myb domain protein 43